Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKE AVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFP EDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSAR LLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKH PFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATT LLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI ALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHL RKASSPNLHRRQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSK NTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEET EASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDWVSELKKRAGW QGLCDR
    • Amino acids
      1 to 506
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSPK 36
    • NEK3
    • NEK3_HUMAN
    • Never in mitosis A-related kinase 3
    • NIMA (never in mitosis gene a) related kinase 3
    • NimA related protein kinase 3
    • NimA-related protein kinase 3
    • Serine/threonine protein kinase Nek3
    • Serine/threonine-protein kinase Nek3
    see all
  • Function
    Kinase that may play a role in mitotic regulation.
  • Sequence similarities
    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab158987 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up