Overview

  • Product name
    Recombinant Human NEK4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKI RRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYR IF
    • Amino acids
      680 to 781
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.7.11.1
    • MGC33171
    • Never in mitosis A related kinase 4
    • Never in mitosis gene A related kinase 4
    • NIMA (never in mitosis gene a) related kinase 4
    • NIMA (never in mitosis gene a)-related expressed kinase 4
    • NIMA related kinase 4
    • NimA related protein kinase 4
    • NLK2
    • NRK2
    • OTTHUMP00000213582
    • Pp12301
    • Serine/threonine kinase 2
    • Serine/threonine protein kinase 2
    • Serine/threonine protein kinase Nek4
    • Serine/threonine protein kinase NRK2
    • STK2
    see all
  • Relevance
    NEK4 (NIMA related kinase 4) is a serine/threonine protein kinase related to the asperigillus NIMA (never in mitosis gene a) kinase. NEK4 is proposed to play a role in cell division. Highest expression in adult heart, followed by pancreas, skeletal muscle, brain, liver, kidney, lung and placenta. Present in most primary carcinomas. There are two named isoforms produced by alternative splicing.
  • Cellular localization
    Nuclear

Images

  • ab159601 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up