Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKK IGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQV
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Highly similar to cell cycle protein kinase CDC5/MSD2
    • NEK6
    • NEK6_HUMAN
    • Never in mitosis A-related kinase 6
    • NIMA (Never In Mitosis Gene A) Related Kinase 6
    • NimA related protein kinase 6
    • NimA-related protein kinase 6
    • Protein kinase SID6 1512
    • Protein kinase SID6-1512
    • Putative serine threonine protein kinase
    • Serine/threonine protein kinase Nek6
    • Serine/threonine-protein kinase Nek6
    • SID6 1512
    • SID61512
    see all
  • Function
    Activated during M phase. Required for chromosome segregation at metaphase-anaphase transition and therefore for mitotic progression. Inhibition of activity results in apoptosis. Phosphorylates KIF11 to promote mitotic spindle formation.
  • Tissue specificity
    Ubiquitous, with highest expression in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab153128 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up