Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYR AACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYAS FIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALE HMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTP YYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKI EQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTA SS
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 302
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      NM_133494.

Specifications

Our Abpromise guarantee covers the use of ab196067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 47 pmol/min/µg

     

    Assay was performed in a 25 µl reaction containing 40 mM Tris, pH 7.4, 20 mM MgCl2, 0.1 mg/ml BSA, 100 µM ATP, 0.2 mg/ml Casein and ab196067 for 50 min at 30°C.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 72 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.49% Glutathione, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • EC 2.7.11.1
    • NEK7
    • NEK7_HUMAN
    • Never in mitosis A-related kinase 7
    • Never in mitosis gene a-related kinase 7
    • NIMA (never in mitosis gene a) related kinase 7
    • NIMA (never in mitosis gene a)-related expressed kinase 7
    • NimA related protein kinase 7
    • NIMA-related kinase 7
    • NimA-related protein kinase 7
    • Serine/threonine-protein kinase Nek7
    see all
  • Tissue specificity
    Highly expressed in lung, muscle, testis, brain, heart, liver, leukocyte and spleen. Lower expression in ovary, prostate and kidney. No expression seen in small intestine.
  • Sequence similarities
    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2.98 μg ab196067 followed by Coomassie staining.

  • Kinase assay using ab196067 showing specific activity as 47 pmol/min/µg.

References

ab196067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up