Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQN ECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLL EEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGI SKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLK RAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLS HIMAQPLCIRALLNLHTDVGSVRMRRAEKSVAPSNTGSRTTSVRCRGIPR GPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRS GRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSGVTIKHVACGD FFTACLTDRGIIMTFGSGSNGCLGHGSLTDISQPTIVEALLGYEMVQVAC GASHVLALSTERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQEAQRV VCGIDSSMILTVPGQALACGSNRFNKLGLDHLSLGEEPVPHQQVEEALSF TLLGSAPLDQEPLLSIDLGTAHSAAVTASGDCYTFGSNQHGQLGTNTRRG SRAPCKVQGLEGIKMAMVACGDAFTVAIGAESEVYSWGKGARGRLGRRDE DAGLPRPVQLDETHPYTVTSVSCCHGNTLLAVRSVTDEPVPP
    • Amino acids
      1 to 692
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • JCK
    • NEK 8
    • NEK12A
    • NEK8
    • NEK8_HUMAN
    • Nephrocystin 9
    • Never in mitosis A-related kinase 8
    • NIMA (never in mitosis gene a) related kinase 8
    • NIMA related kinase 8
    • NIMA-family kinase NEK8
    • NIMA-related kinase 12a
    • Nima-related protein kinase 12a
    • NimA-related protein kinase 8
    • NPHP9
    • Serine/threonine-protein kinase Nek8
    see all
  • Function
    Required for renal tubular integrity.
  • Tissue specificity
    Highest expression in thyroid, adrenal gland and skin. Low levels in spleen, colon and uterus. Overexpressed in breast tumors, with highest expression in infiltrating ductal carcinomas and moderate levels in mucinous adenocarcinoma.
  • Sequence similarities
    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
    Contains 5 RCC1 repeats.
  • Cellular localization
    Cytoplasm. Predominantly cytoplasmic.
  • Information by UniProt

Images

  • ab166159 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166159 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up