Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92832
    • SpeciesHuman
    • SequenceMPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSG MHNASKAFLFQDIEREIHAAPHVSEKLIQLFRNKSEFTILATVQQKPSTS GVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEALPYRMADGQWH KVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLF KGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKM TAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILT KSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPK CGENSECKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCHANTV CVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDENAICTNTVQGH SCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDI DECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLK EDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGH KLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCV SDPCLADNITYDIRKTCLDSYGVSRLSGSVWTMAGSPCTTCKCKNGRVCC SVDFECLQNN
    • Molecular weight115 kDa including tags
    • Amino acids1 to 810

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ45906
    • IDH3GL
    • NEL like 1 (chicken)
    • NEL like protein 1
    • Nel related protein 1
    • NEL-like 1 (chicken)
    • NEL-like protein 1
    • Nel-related protein 1
    • NELL 1 protein short isoform
    • Nell1
    • NELL1_HUMAN
    • Neural epidermal growth factor like 1
    • NRP1
    • Protein kinase C binding protein NELL1
    • Protein kinase C-binding protein NELL1
    see all
  • FunctionInvolved in the control of cell growth and differentiation.
  • Sequence similaritiesContains 6 EGF-like domains.
    Contains 1 TSP N-terminal (TSPN) domain.
    Contains 5 VWFC domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human NELL1 protein images

  • 12.5% SDS-PAGE showing ab116955 at approximately 115.17kDa stained with Coomassie Blue.

References for Recombinant Human NELL1 protein (ab116955)

ab116955 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"