Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSC RECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      304 to 403

Specifications

Our Abpromise guarantee covers the use of ab116956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ45906
    • IDH3GL
    • NEL like 1 (chicken)
    • NEL like protein 1
    • Nel related protein 1
    • NEL-like 1 (chicken)
    • NEL-like protein 1
    • Nel-related protein 1
    • NELL 1 protein short isoform
    • Nell1
    • NELL1_HUMAN
    • Neural epidermal growth factor like 1
    • NRP1
    • Protein kinase C binding protein NELL1
    • Protein kinase C-binding protein NELL1
    see all
  • Function
    Involved in the control of cell growth and differentiation.
  • Sequence similarities
    Contains 6 EGF-like domains.
    Contains 1 TSP N-terminal (TSPN) domain.
    Contains 5 VWFC domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human NELL1 protein images

  • 12.5% SDS-PAGE showing ab116956 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human NELL1 protein (ab116956)

ab116956 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up