Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSC RECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      304 to 403

Specifications

Our Abpromise guarantee covers the use of ab116956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ45906
    • IDH3GL
    • NEL like 1 (chicken)
    • NEL like protein 1
    • Nel related protein 1
    • NEL-like 1 (chicken)
    • NEL-like protein 1
    • Nel-related protein 1
    • NELL 1 protein short isoform
    • Nell1
    • NELL1_HUMAN
    • Neural epidermal growth factor like 1
    • NRP1
    • Protein kinase C binding protein NELL1
    • Protein kinase C-binding protein NELL1
    see all
  • Function
    Involved in the control of cell growth and differentiation.
  • Sequence similarities
    Contains 6 EGF-like domains.
    Contains 1 TSP N-terminal (TSPN) domain.
    Contains 5 VWFC domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116956 at approximately 36.63kDa stained with Coomassie Blue.

References

ab116956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up