Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVY SSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      301 to 400

Specifications

Our Abpromise guarantee covers the use of ab116829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A330108N19Rik
    • Mel91
    • MEL91 protein
    • NEL like 2 (chicken)
    • NEL-like protein 2
    • Nel-related protein 2
    • NELL2
    • NELL2_HUMAN
    • Neural epidermal growth factor like 2
    • NRP2
    • Protein kinase C-binding protein NELL2
    • R75516
    see all
  • Sequence similarities
    Contains 6 EGF-like domains.
    Contains 1 TSP N-terminal (TSPN) domain.
    Contains 5 VWFC domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116829 at approximately 36.63 kDa.

References

ab116829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up