Recombinant Human Nephrin protein (ab114263)

Overview

  • Product nameRecombinant Human Nephrin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60500
    • SpeciesHuman
    • SequenceGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPR YRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
    • Molecular weight36 kDa including tags
    • Amino acids33 to 122

Specifications

Our Abpromise guarantee covers the use of ab114263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CNF
    • Nephrin
    • Nephrosis 1 congenital Finnish type
    • Nephrosis 1, congenital, Finnish type (nephrin)
    • NPHN
    • NPHN_HUMAN
    • NPHS 1
    • Nphs1
    • Renal glomerulus specific cell adhesion receptor
    • Renal glomerulus-specific cell adhesion receptor
    see all
  • FunctionSeems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
  • Tissue specificitySpecifically expressed in podocytes of kidney glomeruli.
  • Involvement in diseaseDefects in NPHS1 are the cause of nephrotic syndrome type 1 (NPHS1) [MIM:256300]; also known as Finnish congenital nephrosis (CNF). A renal disease characterized clinically by proteinuria, hypoalbuminemia, hyperlipidemia, and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily.
    Contains 1 fibronectin type-III domain.
    Contains 8 Ig-like C2-type (immunoglobulin-like) domains.
  • Developmental stageIn 23-week-old embryo found in epithelial podocytes of the periphery of mature and developing glomeruli.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Cellular localizationCell membrane. Predominantly located at podocyte slit diaphragm between podocyte foot processes. Also associated with podocyte apical plasma membrane.
  • Information by UniProt

Recombinant Human Nephrin protein images

  • ab114263 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Nephrin protein (ab114263)

ab114263 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"