Recombinant Human Neprilysin-2 protein (ab164012)

Overview

  • Product name
    Recombinant Human Neprilysin-2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKSEGPVGMVESAGRAGQKRPGFLEGGLLLLLLLVTAALVALGVLYADR RGKQLPRLASRLCFLQEERTFVKRKPRGIPEAQEVSEVCTTPGCVIAAAR ILQNMDPTTEPCDDFYQFACGGWLRRHVIPETNSRYSIFDVLRDELEVIL KAVLENSTAKDRPAVEKARTLYRSCMNQSVIEKRGSQPLLDILEVVGGWP VAMDRWNETVGLEWELERQLALMNSQFNRRVLIDLFIWNDDQNSSRHIIY IDQPTLGMPSREYYFNGGSNRKVREAYLQFMVSVATLLREDANLPRDSCL VQEDMVQVLELETQLAKATVPQEERHDVIALYHRMGLEELQSQFGLKGFN WTLFIQTVLSSVKIKLLPDEEVVVYGIPYLQNLENIIDTYSARTIQNYLV WRLVLDRIGSLSQRFKDTRVNYRKALFGTMVEEVRWRECVGYVNSNMENA VGSLYVREAFPGDSKSMVRELIDKVRTVFVETLDELGWIDEESKKKAQEK AMSIREQIGHPDYILEETNRRLDEEYSNLNFSEDLYFENSLQNLKVGAQR SLRKLREKVDPNLWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKEQPQ ALNFGGIGMVIGHEITHGFDDNGRNFDKNGNMMDWWSNFSTQHFREQSEC MIYQYGNYSWDLADEQNVNGFNTLGENIADNGGVRQAYKAYLKWMAEGGK DQQLPGLDLTHEQLFFINYAQVWCGSYRPEFAIQSIKTDVHSPLKYRVLG SLQNLAAFADTFHCARGTPMHPKERCRVW
    • Amino acids
      1 to 779
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mel transforming oncogene like 1
    • Membrane metallo endopeptidase like 1
    • Membrane metallo endopeptidase like 2
    • Membrane metallo-endopeptidase-like 1
    • Membrane metallo-endopeptidase-like 2
    • MMEL1
    • MMEL1_HUMAN
    • NEP2
    • NEP2(m)
    • NEP2(s)
    • NEPII
    • Neprilysin 2
    • Neprilysin II
    • Neprilysin Like 1
    • Neprilysin-2
    • Neprilysin-2 secreted
    • Neprilysin-like Protease beta
    • Neprilysin-like Protease gamma
    • NL1
    • NL2
    • SEP
    • soluble form
    • Soluble secreted endopeptidase
    see all
  • Function
    Metalloprotease involved in sperm function, possibly by modulating the processes of fertilization and early embryonic development. Degrades a broad variety of small peptides with a preference for peptides shorter than 3 kDa containing neutral bulky aliphatic or aromatic amino acid residues. Shares the same substrate specificity with MME and cleaves peptides at the same amide bond.
  • Tissue specificity
    Predominantly expressed in testis. Weakly expressed in brain, kidney and heart.
  • Sequence similarities
    Belongs to the peptidase M13 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane. Secreted. A secreted form produced by proteollytic cleavage also exists.
  • Information by UniProt

Images

  • ab164012 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up