Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKHNYS QDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
    • Amino acids
      434 to 533
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI851453
    • BCTL1
    • Brain specific transmembrane protein containing 2 CUB and 1 LDL receptor class A domains protein 1
    • Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1
    • BTCL1
    • C130005O10Rik
    • FLJ41325
    • Neto1
    • NETO1_HUMAN
    • Neuropilin and tolloid like 1
    • Neuropilin and tolloid-like protein 1
    • RGD1566269
    see all
  • Function
    Involved in the development and/or maintenance of neuronal circuitry. Accessory subunit of the neuronal N-methyl-D-aspartate receptor (NMDAR) critical for maintaining the abundance of GRIN2A-containing NMDARs in the postsynaptic density. Regulates long-term NMDA receptor-dependent synaptic plasticity and cognition, at least in the context of spatial learning and memory.
  • Tissue specificity
    Isoform 1 and isoform 2 are retina-specific. Isoform 3 is found in retina as well as at lower levels in adult and fetal brain.
  • Sequence similarities
    Contains 2 CUB domains.
    Contains 1 LDL-receptor class A domain.
  • Cellular localization
    Secreted; Cell membrane and Cell membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Component of the postsynaptic density (PSD) of excitatory synapses.
  • Information by UniProt

Images

  • ab164367 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up