Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFN STFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
    • Amino acids
      426 to 525
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain specific transmembrane protein
    • Brain specific transmembrane protein containing 2 CUB and 1 LDL receptor class A domains protein 2
    • Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2
    • BTCL2
    • FLJ10430
    • FLJ14724
    • FLJ90456
    • NEOT2
    • NETO 2
    • Neto2
    • NETO2_HUMAN
    • Neuropilin (NRP) and tolloid (TLL) like 2
    • Neuropilin and tolloid like protein 2
    • Neuropilin and tolloid-like protein 2
    see all
  • Function
    Accessory subunit of neuronal kainate-sensitive glutamate receptors, GRIK2 and GRIK3. Increases kainate-receptor channel activity, slowing the decay kinetics of the receptors, without affecting their expression at the cell surface, and increasing the open probability of the receptor channels. Modulates the agonist sensitivity of kainate receptors. Slows the decay of kainate receptor-mediated excitatory postsynaptic currents (EPSCs), thus directly influencing synaptic transmission.
  • Sequence similarities
    Contains 2 CUB domains.
    Contains 1 LDL-receptor class A domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164365 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up