Recombinant Human Netrin G2 protein (ab164622)

Overview

  • Product name
    Recombinant Human Netrin G2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCS HENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPL
    • Amino acids
      21 to 119
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA479K20.1
    • bA479K20.1 (novel protein)
    • KIAA0625
    • KIAA1857
    • laminet 2
    • Laminet-2
    • LHLL9381
    • Lmnt2
    • MGC21884
    • Netrin G1
    • Netrin-G2
    • NTNG1
    • NTNG2
    • NTNG2_HUMAN
    see all
  • Function
    Promotes neurite outgrowth of both axons and dendrites.
  • Sequence similarities
    Contains 3 laminin EGF-like domains.
    Contains 1 laminin N-terminal domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164622 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up