Overview

  • Product nameRecombinant Human NEU2 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y3R4
    • SpeciesHuman
    • SequenceAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQ RVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
    • Molecular weight35 kDa including tags
    • Amino acids180 to 268

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytosolic sialidase
    • MGC129579
    • N acetyl alpha neuraminidase 2
    • N-acetyl-alpha-neuraminidase 2
    • Neu2
    • NEUR2_HUMAN
    • Neuraminidase 2
    • OTTHUMP00000164374
    • SIAL2
    • Sialidase 2
    • Sialidase-2
    see all
  • FunctionHydrolyzes sialylated compounds.
  • Tissue specificityExpressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 33 family.
    Contains 2 BNR repeats.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NEU2 protein images

  • 12.5% SDS-PAGE showing ab116967 at approximately 35.42kDa stained with Coomassie Blue.

References for Recombinant Human NEU2 protein (ab116967)

ab116967 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"