Overview

  • Product name
    Recombinant Human NEU2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQ RVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
    • Molecular weight
      35 kDa including tags
    • Amino acids
      180 to 268

Specifications

Our Abpromise guarantee covers the use of ab116967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytosolic sialidase
    • MGC129579
    • N acetyl alpha neuraminidase 2
    • N-acetyl-alpha-neuraminidase 2
    • Neu2
    • NEUR2_HUMAN
    • Neuraminidase 2
    • OTTHUMP00000164374
    • SIAL2
    • Sialidase 2
    • Sialidase-2
    see all
  • Function
    Hydrolyzes sialylated compounds.
  • Tissue specificity
    Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 33 family.
    Contains 2 BNR repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116967 at approximately 35.42kDa stained with Coomassie Blue.

References

ab116967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up