Overview

  • Product name
    Recombinant Human NEU2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQ RVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
    • Molecular weight
      35 kDa including tags
    • Amino acids
      180 to 268

Specifications

Our Abpromise guarantee covers the use of ab116967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytosolic sialidase
    • MGC129579
    • N acetyl alpha neuraminidase 2
    • N-acetyl-alpha-neuraminidase 2
    • Neu2
    • NEUR2_HUMAN
    • Neuraminidase 2
    • OTTHUMP00000164374
    • SIAL2
    • Sialidase 2
    • Sialidase-2
    see all
  • Function
    Hydrolyzes sialylated compounds.
  • Tissue specificity
    Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 33 family.
    Contains 2 BNR repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human NEU2 protein images

  • 12.5% SDS-PAGE showing ab116967 at approximately 35.42kDa stained with Coomassie Blue.

References for Recombinant Human NEU2 protein (ab116967)

ab116967 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up