Recombinant Human NEURL2 protein (denatured) (ab171589)

Overview

  • Product name
    Recombinant Human NEURL2 protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human NEURL2 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAAASEPVDSGALWGLERPEPPPTRFH RVHGANIRVDPSGTRATRVESFAHGVCFSREPLAPGQVFLVEIEEKELGW CGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHNRVPREGR PEAEAAAPSRPPTLLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYE LNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLY AVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKE LKDFCKYE
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 285
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab171589 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • NEUL2_HUMAN
    • Neuralized like protein 2
    • Neuralized-like protein 2
    • NEURL2
  • Function
    Plays an important role in the process of myofiber differentiation and maturation. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. Probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma.
  • Tissue specificity
    Expressed specifically in skeletal and cardiac muscles.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 NHR (neuralized homology repeat) domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS domain mediates the interaction with TCEB1 and TCEB2, while the NHR domain may be involved in ubiquitination substrate binding.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171589 at 3µg.

References

ab171589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up