Recombinant Human Neurobeachin protein (ab162045)

Overview

  • Product name
    Recombinant Human Neurobeachin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVSD DLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSI
    • Amino acids
      1133 to 1220
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCL8B
    • FLJ10197
    • KIAA1544
    • Lysosomal trafficking regulator 2
    • Lysosomal-trafficking regulator 2
    • LYST2
    • NBEA
    • NBEA_HUMAN
    • Neurobeachin
    • Protein BCL8B
    • Protein neurobeachin
    • RP11-270C18.1
    see all
  • Function
    Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins.
  • Tissue specificity
    Predominant in many brain structures. Also expressed at medium levels in spleen, thymus, prostate, testis and ovary. Low level expression is seen in heart, kidney, pancreas, skeletal muscle and intestine.
  • Sequence similarities
    Belongs to the WD repeat neurobeachin family.
    Contains 1 BEACH domain.
    Contains 5 WD repeats.
  • Domain
    RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab162045 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up