Recombinant Human Neurochondrin protein (ab161548)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS EQFAALLLVTKAVKAGDIDAKTRRRIFDAVGFTFPNRLLTTKEAPDGCPD HVLRALGVALLACFCSDPELAAHPQVLNKIPILSTFLTARGDPDDAARRS MIDDTYQCLTAVAGTPRGPRHLIAGGTVSALCQAYLGHGYGFDQALALLV GLLAAAETQCWKEAEPDLLAVLRGLSEDFQKAEDASKFELCQLLPLFLPP TTVPPECYRDLQAGLARILGSKLSSWQRNPALKLAARLAHACGSDWIPAG SSGSKFLALLVNLACVEVRLALEETGTEVKEDVVTACYALMELGIQECTR CEQSLLKEPQKVQLVSVMKEAIGAVIHYLLQVGSEKQKEPFVFASVRILG AWLAEETSSLRKEVCQLLPFLVRYAKTLYEEAEEANDLSQQVANLAISPT TPGPTWPGDALRLLLPGWCHLTVEDGPREILIKEGAPSLLCKYFLQQWEL TSPGHDTSVLPDSVEIGLQTCCHIFLNLVVTAPGLIKRDACFTSLMNTLM TSLPALVQQQGRLLLAANVATLGLLMARLLSTSPALQGTPASRGFFAAAI LFLSQSHVARATPGSDQAVLALSPEYEGIWADLQELWFLGMQAFTGCVPL LPWLAPAALRSRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVELARANRL CREAMRLQAGEETASHYRMAALEQCLSEP
    • Amino acids
      1 to 729
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AU042419
    • KIAA0607
    • M-Sema F-associating protein of 75 kDa
    • MGC93259
    • MMS10-AE
    • Ms10ae
    • NCDN
    • NCDN-1
    • NCDN-2
    • Neurochondrin 1
    • Norbin
    • OTTHUMP00000065369
    • OTTHUMP00000065370
    • OTTHUMP00000065371
    • Sfap75
    see all
  • Relevance
    Neurochondrin is a leucine rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin dependent protein kinase II phosphorylation and may be essential for spatial learning processes.
  • Cellular localization
    Cytoplasm. Cell projection, dendrite. Note: Localizes to somatic regions of neurons.

Images

  • ab161548 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up