Recombinant Human Neurogenin 1 protein (ab114475)

Overview

  • Product nameRecombinant Human Neurogenin 1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92886
    • SpeciesHuman
    • SequenceSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKI ETLRFAYNYIWALAETLRLADQGLPGGGARER
    • Molecular weight35 kDa including tags
    • Amino acids82 to 163

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AKA
    • Ath4c
    • bHLHa6
    • Class A basic helix-loop-helix protein 6
    • Helix loop helix protein mATH 4C
    • MATH4C
    • NeuroD3
    • Neurog 1
    • Neurog1
    • Neurogenic basic helix loop helix protein
    • Neurogenic basic-helix-loop-helix protein
    • Neurogenic differentiation 3
    • Neurogenic differentiation factor 3
    • Neurogenin-1
    • Neurogenin1
    • Ngn
    • NGN-1
    • Ngn1
    • NGN1_HUMAN
    see all
  • FunctionAppears to mediate neuronal differentiation.
  • Tissue specificityExpression restricted to the embryonic nervous system.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Neurogenin 1 protein images

  • ab114475 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Neurogenin 1 protein (ab114475)

ab114475 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"