Recombinant Human Neurogranin protein (ab114665)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGE RGRKGPGPGGPGGAGVARGGAGGGPSGD
    • Molecular weight
      35 kDa
    • Amino acids
      1 to 78

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Protein kinase C substrate RC3
    • Calmodulin binding protein
    • Hng
    • NEUG(55-78)
    • NEUG_HUMAN
    • Neurogranin (protein kinase C substrate)
    • Ng
    • NRGN
    • Protein kinase C substrate
    • RC3
    see all
  • Function
    Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium.
  • Tissue specificity
    In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease.
  • Sequence similarities
    Belongs to the neurogranin family.
    Contains 1 collagen-like domain.
    Contains 1 IQ domain.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114665 on a 12.5% gel stained with Coomassie Blue.

References

ab114665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up