Recombinant Human Neurokinin 1 Receptor protein (ab152723)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTI STVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      309 to 407

Specifications

Our Abpromise guarantee covers the use of ab152723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Neurokinin 1
    • NK 1 receptor
    • NK 1R
    • NK-1 receptor
    • NK-1R
    • NK1 receptor
    • NK1R
    • NK1R_HUMAN
    • NKIR
    • SPR
    • Substance P receptor
    • Substance-P receptor
    • TAC 1R
    • TAC1R
    • Tachykinin 1 receptor (substance P receptor neurokinin 1 receptor)
    • Tachykinin receptor 1
    • Tachykinin receptor 1 (substance P receptor neurokinin 1 receptor)
    • TACR1
    see all
  • Function
    This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152723 stained with Coomassie Blue.

References

ab152723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up