Recombinant Human Neuronatin protein (ab112328)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARS EVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 81
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Neuronatin
    • NNAT
    • NNAT_HUMAN
    • Peg 5
    • Peg5
    see all
  • Function
    May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
  • Sequence similarities
    Belongs to the neuronatin family.
  • Developmental stage
    Abundant in 18-24 week old fetal brain. Postnatally its expression decline and only minimal levels were present in adulthood.
  • Information by UniProt

Images

  • ab112328 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up