Recombinant Human Neuronatin protein (ab112328)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16517
    • SpeciesHuman
    • SequenceMAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARS EVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
    • Molecular weight35 kDa including tags
    • Amino acids1 to 81
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Neuronatin
    • NNAT
    • NNAT_HUMAN
    • Peg 5
    • Peg5
    see all
  • FunctionMay participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
  • Sequence similaritiesBelongs to the neuronatin family.
  • Developmental stageAbundant in 18-24 week old fetal brain. Postnatally its expression decline and only minimal levels were present in adulthood.
  • Information by UniProt

Recombinant Human Neuronatin protein images

  • ab112328 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Neuronatin protein (ab112328)

ab112328 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"