Recombinant Human Neuropeptide Y protein (ab112331)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP01303
    • SpeciesHuman
    • SequenceMLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYS ALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
    • Molecular weight37 kDa including tags
    • Amino acids1 to 97
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • C-flanking peptide of NPY
    • CPON
    • Neuropeptide tyrosine
    • Neuropeptide Y precursor
    • NPY
    • NPY_HUMAN
    • Pro neuropeptide Y
    • PYY 4
    • PYY4
    • Y Neuropeptide
    see all
  • FunctionNPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Tissue specificityOne of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
  • Sequence similaritiesBelongs to the NPY family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Neuropeptide Y protein images

  • ab112331 run on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Neuropeptide Y protein (ab112331)

ab112331 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

The products you listed are the actual Neuropeptide Y proteins, not the antibodies.

We do carry antibodies to Neuropeptide Y that have been tested in mouse samples:
ab30914 (http://www.abcam.com/Neurop...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"