Recombinant Human Neuropeptide Y protein (ab114205)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLL MRESTENVPRTRLEDPAMW
    • Molecular weight
      33 kDa including tags
    • Amino acids
      29 to 97

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • C-flanking peptide of NPY
    • CPON
    • Neuropeptide tyrosine
    • Neuropeptide Y precursor
    • NPY
    • NPY_HUMAN
    • Pro neuropeptide Y
    • PYY 4
    • PYY4
    • Y Neuropeptide
    see all
  • Function
    NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Tissue specificity
    One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
  • Sequence similarities
    Belongs to the NPY family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab114205 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

The products you listed are the actual Neuropeptide Y proteins, not the antibodies.

We do carry antibodies to Neuropeptide Y that have been tested in mouse samples:
ab30914 (http://www.abcam.com/Neurop...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up