Recombinant Human Neurotensin protein (ab114617)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWE LIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
    • Molecular weight
      37 kDa including tags
    • Amino acids
      71 to 170

Specifications

Our Abpromise guarantee covers the use of ab114617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Human proneurotensin
    • Large neuromedin N
    • Neuromedin N preproprotein
    • Neurotensin/neuromedin N
    • NEUT_HUMAN
    • NmN
    • NMN 125
    • NmN-125
    • NN
    • NT
    • NT/N
    • NTRH
    • NTS
    • NTS1
    • Pro neurotensin/neuromedin
    • Proneuromedin N mRNA
    • Tail peptide
    see all
  • Function
    Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
  • Sequence similarities
    Belongs to the neurotensin family.
  • Cellular localization
    Secreted. Cytoplasmic vesicle > secretory vesicle. Packaged within secretory vesicles.
  • Information by UniProt

Recombinant Human Neurotensin protein images

  • ab144617 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Neurotensin protein (ab114617)

ab114617 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up