Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVD PPPSTLTTPLCLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPL GGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHLY LPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAA ARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVT DENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFT WSKPKPGHTPIFRTSSLPPLDWPLPAHFGQCELKIEVQPKTHHRAHYETE GSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYLRPHAFYQVHR ITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIEL RKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELP HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKI IREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICS IPQTYASMVTSSHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGS SYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLS SIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPM PYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDP ASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDDQFISDLEHQPSGSA EKWPNHSVLSCPAPFWRI
    • Molecular weight
      144 kDa
    • Amino acids
      1 to 1068

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C80703
    • cytoplasmic 3
    • D8Ertd281e
    • NF AT4
    • NF ATc3
    • NF-AT4
    • NF-ATc3
    • NFAC3_HUMAN
    • NFATc3
    • NFATx
    • Nuclear factor of activated T cells, cytoplasmic 3
    • nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 3
    • Nuclear factor of activated T-cells
    • T cell transcription factor NFAT4
    • T-cell transcription factor NFAT4
    see all
  • Function
    Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2.
  • Tissue specificity
    Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.
  • Sequence similarities
    Contains 1 RHD (Rel-like) domain.
  • Domain
    Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
  • Post-translational
    modifications
    Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.
  • Information by UniProt

Recombinant Human NFAT4 protein images

  • SDS-PAGE analysis of ab114667 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human NFAT4 protein (ab114667)

ab114667 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up