Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVD PPPSTLTTPLCLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPL GGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHLY LPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAA ARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVT DENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFT WSKPKPGHTPIFRTSSLPPLDWPLPAHFGQCELKIEVQPKTHHRAHYETE GSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYLRPHAFYQVHR ITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIEL RKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELP HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKI IREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICS IPQTYASMVTSSHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGS SYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLS SIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPM PYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDP ASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDDQFISDLEHQPSGSA EKWPNHSVLSCPAPFWRI
    • Molecular weight
      144 kDa
    • Amino acids
      1 to 1068

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C80703
    • cytoplasmic 3
    • D8Ertd281e
    • NF AT4
    • NF ATc3
    • NF-AT4
    • NF-ATc3
    • NFAC3_HUMAN
    • NFATc3
    • NFATx
    • Nuclear factor of activated T cells, cytoplasmic 3
    • nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 3
    • Nuclear factor of activated T-cells
    • T cell transcription factor NFAT4
    • T-cell transcription factor NFAT4
    see all
  • Function
    Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2.
  • Tissue specificity
    Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.
  • Sequence similarities
    Contains 1 RHD (Rel-like) domain.
  • Domain
    Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
  • Post-translational
    modifications
    Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114667 on a 12.5% gel stained with Coomassie Blue.

References

ab114667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up