Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO94916
    • SpeciesHuman
    • SequenceFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLM AISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQ NQGNNLTGSF
    • Molecular weight38 kDa
    • Amino acids1422 to 1531

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    Other

    SDS-PAGE

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Glutamine rich protein H65
    • KIAA0827
    • NF AT5
    • NF-AT5
    • NFAT 5
    • NFAT L1
    • NFAT like protein 1
    • NFAT5
    • NFAT5_HUMAN
    • NFATL 1
    • NFATL1
    • NFATZ
    • Nuclear factor of activated T cells
    • Nuclear factor of activated T cells 5
    • Nuclear factor of activated T cells 5 tonicity responsive
    • Nuclear factor of activated T-cells 5
    • OREBP
    • Osmotic response element binding protein
    • T cell transcription factor NFAT 5
    • T cell transcription factor NFAT5
    • T-cell transcription factor NFAT5
    • TonE binding protein
    • TonE-binding protein
    • TonEBP
    • Tonicity responsive enhancer binding protein
    • Tonicity-responsive enhancer-binding protein
    see all
  • FunctionPlays a role in the inducible expression of genes. Regulates hypertonicity-induced cellular accumulation of osmolytes.
  • Tissue specificityHighest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon.
  • Sequence similaritiesContains 1 RHD (Rel-like) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NFAT5 protein images

  • 12.5% SDS-PAGE analysis of NFAT5 protein (ab112396), stained with Coomassie Blue.

References for Recombinant Human NFAT5 protein (ab112396)

ab112396 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"