Recombinant Human NFIB / NF1B2 protein (ab152572)

Overview

  • Product name
    Recombinant Human NFIB / NF1B2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMS KDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKK HPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGER LMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDP AKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYY HDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLK NYVPSYDPSSPQTSQSWYLG
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 420

Specifications

Our Abpromise guarantee covers the use of ab152572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCAAT Box Binding Transcription Factor
    • CCAAT-box-binding transcription factor
    • CTF
    • HMGIC/NFIB
    • NF-I/B
    • NF1-B
    • NF1B
    • NF1B2
    • NFI-B
    • NFI-RED
    • Nfib
    • NFIB_HUMAN
    • NFIB2
    • NFIB3
    • Nuclear factor 1 B-type
    • Nuclear factor 1/B
    • Nuclear Factor 1B
    • Nuclear Factor I B
    • Nuclear factor I/B
    • TGGCA Binding Protein
    • TGGCA-binding protein
    • TRANSCRIPTION FACTOR NFIB
    see all
  • Function
    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities
    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152572 stained with Coomassie Blue.

References

ab152572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up