Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGS SPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      291 to 390

Specifications

Our Abpromise guarantee covers the use of ab114742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCAAT box binding transcription factor
    • CCAAT-box-binding transcription factor
    • CTF
    • NF-I/X
    • NF1-X
    • NF1A
    • NF1X
    • NFI X
    • NFI-X
    • NFI/X
    • NFIX
    • NFIX_HUMAN
    • Nuclear factor 1 X type
    • Nuclear factor 1 X-type
    • Nuclear factor 1/X
    • Nuclear factor I/X
    • TGGCA binding protein
    • TGGCA-binding protein
    see all
  • Function
    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities
    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human NFIX protein images

  • 12.5% SDS-PAGE showing ab114742 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NFIX protein (ab114742)

ab114742 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up