Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGS SPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      291 to 390

Specifications

Our Abpromise guarantee covers the use of ab114742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCAAT box binding transcription factor
    • CCAAT-box-binding transcription factor
    • CTF
    • NF-I/X
    • NF1-X
    • NF1A
    • NF1X
    • NFI X
    • NFI-X
    • NFI/X
    • NFIX
    • NFIX_HUMAN
    • Nuclear factor 1 X type
    • Nuclear factor 1 X-type
    • Nuclear factor 1/X
    • Nuclear factor I/X
    • TGGCA binding protein
    • TGGCA-binding protein
    see all
  • Function
    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities
    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114742 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up