Recombinant Human NFKBID protein (ab171676)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMEAGPWRVSAPPSGPPQFPAVVPGPSL EVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRR LDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAAT YGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRV LSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLL ELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLR NLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 313
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab171676 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • I-kappa-B-delta
    • IkappaBdelta
    • IkappaBNS
    • IkB-delta
    • IKBD_HUMAN
    • IKBNS
    • NF-kappa-B inhibitor delta
    • NFKBID
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor delta
    • T-cell activation NFKB-like protein
    • TA-NFKBH
    see all
  • Function
    May regulate the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. May also regulate TCR-induced negative selection of thymocytes.
  • Sequence similarities
    Belongs to the NF-kappa-B inhibitor family.
    Contains 6 ANK repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171676 (3µg).

References

ab171676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up