Recombinant Human NFKBIL2 protein (ab158992)

Overview

  • Product name
    Recombinant Human NFKBIL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRTRLYLNLGLTFESLQQTALCNDYFRKSIFLAEQNHLYEDLFRARYNLG TIHWRAGQHSQAMRCLEGARECAHTMRKRFMESECCVVIAQVLQDLG
    • Amino acids
      1 to 97
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • I kappa B related protein
    • I-kappa-B-related protein
    • IkappaBR
    • IKBR
    • Inhibitor of kappa B related protein
    • Inhibitor of kappa B-related protein
    • MMS22L-interacting protein
    • MMS22L-interacting protein, NFBIL2/TONSL
    • NF kappa B inhibitor like protein 2
    • NF-kappa-B inhibitor-like protein 2
    • NFBIL2
    • NFBIL2/TONSL
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor like protein 2
    • Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2
    • Protein IkappaBR
    • Tonsl
    • TONSL_HUMAN
    • Tonsoku-like protein
    • tonsoku-like, DNA repair protein
    see all
  • Function
    Component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks. It may act by mediating the assembly of RAD51 filaments on ssDNA. Within the complex, may act as a scaffold.
  • Tissue specificity
    Expressed in heart, skeletal muscle and tracheal epithelial cells.
  • Sequence similarities
    Belongs to the Tonsoku family.
    Contains 3 ANK repeats.
    Contains 7 LRR (leucine-rich) repeats.
    Contains 8 TPR repeats.
  • Domain
    The ANK repeats mediate the interaction with the MCM complex and histones, while the LRR repeats mediate the interaction with MMS22L.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly nuclear. Localizes to DNA damage sites, accumulates at stressed replication forks.
  • Information by UniProt

Images

  • ab158992 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up