Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRLRVGDRAPQSAVPADTAAAPEVGPVLRPLYMDVQATTPLDPRVLDAML PYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPREIIFTSGAT ESNNIAIKTE
    • Amino acids
      29 to 138
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cysteine desulfurase
    • Cysteine desulfurase, mitochondrial
    • HUSSY 08
    • IscS
    • mitochondrial
    • NFS1
    • NFS1 nitrogen fixation 1
    • NFS1 nitrogen fixation 1 homolog (S. cerevisiae)
    • NFS1_HUMAN
    • NIFS
    • nitrogen fixation 1 (S. cerevisiae, homolog)
    • nitrogen fixation gene 1
    • nitrogen-fixing bacteria S, homolog of
    • nitrogen-fixing bacteria S-like protein
    • OTTHUMP00000030799
    see all
  • Function
    Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor.
  • Tissue specificity
    Predominantly expressed in heart and skeletal muscle. Also found in brain, liver and pancreas.
  • Sequence similarities
    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.
  • Cellular localization
    Cytoplasm. Nucleus and Mitochondrion.
  • Information by UniProt

Images

  • ab160315 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up