Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRK YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS *
    • Molecular weight
      37 kDa including tags
    • Amino acids
      219 to 318

Specifications

Our Abpromise guarantee covers the use of ab114561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAAT box DNA binding protein subunit A
    • CAAT box DNA-binding protein subunit A
    • CBF A
    • CBF B
    • CBFA
    • CBFB
    • CCAAT binding transcription factor subunit B
    • FLJ11236
    • HAP 2
    • HAP2
    • HAP2 CCAAT binding protein
    • NF YA
    • NF-YA
    • NFY protein chain A
    • NFYA
    • NFYA_HUMAN
    • NUCLEAR FACTOR BINDING TO Y BOX OF HLA GENES
    • Nuclear transcription factor Y
    • Nuclear transcription factor Y alpha
    • Nuclear transcription factor Y subunit A
    • Nuclear transcription factor Y subunit alpha
    • Sez10
    • Transcription factor NF Y A subunit
    see all
  • Function
    Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similarities
    Belongs to the NFYA/HAP2 subunit family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114561 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up