Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23511
    • SpeciesHuman
    • SequenceAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRK YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS *
    • Molecular weight37 kDa including tags
    • Amino acids219 to 318

Specifications

Our Abpromise guarantee covers the use of ab114561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAAT box DNA binding protein subunit A
    • CAAT box DNA-binding protein subunit A
    • CBF A
    • CBF B
    • CBFA
    • CBFB
    • CCAAT binding transcription factor subunit B
    • FLJ11236
    • HAP 2
    • HAP2
    • HAP2 CCAAT binding protein
    • NF YA
    • NF-YA
    • NFY protein chain A
    • NFYA
    • NFYA_HUMAN
    • NUCLEAR FACTOR BINDING TO Y BOX OF HLA GENES
    • Nuclear transcription factor Y
    • Nuclear transcription factor Y alpha
    • Nuclear transcription factor Y subunit A
    • Nuclear transcription factor Y subunit alpha
    • Sez10
    • Transcription factor NF Y A subunit
    see all
  • FunctionStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similaritiesBelongs to the NFYA/HAP2 subunit family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NFYA protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human NFYA protein (ab114561)

ab114561 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"