Overview

  • Product name
    Recombinant Human NFYB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKE SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSE ASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG IGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 207

Specifications

Our Abpromise guarantee covers the use of ab114919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CAAT box DNA binding protein subunit B
    • CAAT box DNA-binding protein subunit B
    • CBF A
    • CBF B
    • CCAAT binding transcription factor subunit A
    • HAP 3
    • HAP3
    • NF Y protein chain B
    • NF YB
    • NF-YB
    • NFYB
    • NFYB_HUMAN
    • Nuclear transcription factor Y beta
    • Nuclear transcription factor Y subunit B
    • Nuclear transcription factor Y subunit beta
    • Transcription factor NF Y B subunit
    see all
  • Function
    Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similarities
    Belongs to the NFYB/HAP3 subunit family.
  • Domain
    Can be divided into 3 domains: the weakly conserved A domain, the highly conserved B domain thought to be involved in subunit interaction and DNA binding, and the Glu-rich C domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114919 at approximately 48.51kDa.
    Stained with Coomassie Blue.

References

ab114919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up