Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13952
    • SpeciesHuman
    • SequenceDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISA EAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
    • Molecular weight37 kDa including tags
    • Amino acids14 to 113

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAAT box DNA binding protein subunit C
    • CAAT box DNA-binding protein subunit C
    • CBF C
    • CBFC
    • CCAAT binding factor subunit C
    • CCAAT transcription binding factor subunit gamma
    • DKFZp667G242
    • FLJ45775
    • H1TF2A
    • HAP5
    • histone H1 transcription factor large subunit 2A
    • HSM
    • NF-YC
    • NFYC
    • NFYC_HUMAN
    • Nuclear transcription factor Y gamma
    • Nuclear transcription factor Y subunit C
    • Nuclear transcription factor Y subunit gamma
    • OTTHUMP00000009207
    • OTTHUMP00000009208
    • OTTHUMP00000009209
    • OTTHUMP00000009210
    • OTTHUMP00000009211
    • OTTHUMP00000009212
    • OTTHUMP00000009213
    • OTTHUMP00000009215
    • OTTHUMP00000009217
    • OTTHUMP00000231028
    • Transactivator HSM 1/2
    • transactivator HSM-1
    • Transactivator HSM-1/2
    see all
  • FunctionStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similaritiesBelongs to the NFYC/HAP5 subunit family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NFYC protein images

  • 12.5% SDS-PAGE showing ab117051 at approximately 36.63 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NFYC protein (ab117051)

ab117051 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"