Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQT RNITVDPRLFKKRRLRSPRVL FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDS VSVWVGDKTTATDIKGKEVM VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFV KALTMDGKQAAWRFIRIDTA CVCVLSRKAVR.

Specifications

Our Abpromise guarantee covers the use of ab55441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.
    ab55441 is purified by chromatographic techniques. Purity tested by SDS-PAGE and RP-HPLC.
  • FormLiquid
  • Additional notesab55441 can be dessicated and frozen at -18 centigrade for long term storage. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 50mM Sodium phosphate buffer, 150mM Sodium chloride, pH 7.2

General Info

  • Alternative names
    • Beta nerve growth factor
    • Beta NGF
    • Beta-nerve growth factor
    • Beta-NGF
    • HSAN5
    • MGC161426
    • MGC161428
    • Nerve growth factor
    • Nerve growth factor (beta polypeptide)
    • Nerve growth factor beta
    • Nerve growth factor beta polypeptide
    • Nerve growth factor beta subunit
    • NGF
    • NGF_HUMAN
    • NGFB
    • NID67
    see all
  • FunctionNerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177).
  • Involvement in diseaseNeuropathy, hereditary sensory and autonomic, 5
  • Sequence similaritiesBelongs to the NGF-beta family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human NGF protein (ab55441)

ab55441 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab55441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"