Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ02575
    • SpeciesHuman
    • SequenceMMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEP GEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRK LLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
    • Molecular weight41 kDa including tags
    • Amino acids1 to 133

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • bHLHa35
    • Class A basic helix-loop-helix protein 35
    • Helix-loop-helix protein 1
    • HEN-1
    • HEN1
    • HEN1_HUMAN
    • Nescient helix loop helix 1
    • Nhlh1
    • NSCL
    • NSCL-1
    • NSCL1
    • OTTHUMP00000031860
    see all
  • FunctionMay serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NHLH1 protein images

  • 12.5% SDS-PAGE showing ab117028 at approximately 40.74 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NHLH1 protein (ab117028)

ab117028 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"