Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTKIKADPDGPEAQAEACSGERTYQELLVN QNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMV LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVK PHEEYQEAYDECLEEVQSLPLPL
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 153
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab102027 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DKCB2
    • FLJ20479
    • H/ACA ribonucleoprotein complex subunit 2
    • NHP2
    • NHP2 like protein
    • NHP2 ribonucleoprotein
    • NHP2 ribonucleoprotein homolog
    • NHP2 ribonucleoprotein homolog (yeast) 1
    • NHP2, S. cerevisiae, homolog of
    • NHP2_HUMAN
    • NHP2P
    • NOLA2
    • Nucleolar protein family A member 2
    • Nucleolar protein family A member 2 (H/ACA small nucleolar RNPs)
    • snoRNP protein NHP2
    see all
  • Function
    Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
  • Tissue specificity
    Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver.
  • Involvement in disease
    Dyskeratosis congenita, autosomal recessive, 2
  • Sequence similarities
    Belongs to the ribosomal protein L7Ae family.
  • Developmental stage
    Transcript peaks at G1/S transition.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > Cajal body. Also localized to Cajal bodies.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102027 (3µg)

References

ab102027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up