Recombinant Human NHP2L1 protein (ab101947)

Overview

  • Product nameRecombinant Human NHP2L1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP55769
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLV QQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDK NVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL LV
    • Molecular weight17 kDa including tags
    • Amino acids1 to 128
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101947 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 7.5

General Info

  • Alternative names
    • [U4/U6.U5] tri snRNP
    • 15.5 kD RNA binding protein
    • High mobility group like nuclear protein 2 homolog 1
    • hSNU13
    • NHP2 non histone chromosome protein 2 like 1 (S. cerevisiae)
    • NHP2L 1
    • NHP2L1
    • NHPX
    • OTK27
    • SNU13
    see all
  • RelevanceOriginally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri snRNP. It binds to the 5' stem loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
  • Cellular localizationNucleus › nucleolus. Note: Concentrated in the dense fibrillar component of the nucleolus.

Recombinant Human NHP2L1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101947.

References for Recombinant Human NHP2L1 protein (ab101947)

ab101947 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"