Recombinant Human NHP2L1 protein (ab101947)

Overview

  • Product name
    Recombinant Human NHP2L1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLV QQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDK NVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL LV
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 128
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101947 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 7.5

General Info

  • Alternative names
    • [U4/U6.U5] tri snRNP
    • 15.5 kD RNA binding protein
    • High mobility group like nuclear protein 2 homolog 1
    • hSNU13
    • NHP2 non histone chromosome protein 2 like 1 (S. cerevisiae)
    • NHP2L 1
    • NHP2L1
    • NHPX
    • OTK27
    • SNU13
    see all
  • Relevance
    Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri snRNP. It binds to the 5' stem loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
  • Cellular localization
    Nucleus › nucleolus. Note: Concentrated in the dense fibrillar component of the nucleolus.

Images

  • 15% SDS-PAGE analysis of 3µg ab101947.

References

ab101947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up