Recombinant Human Nicotinic Acetylcholine Receptor alpha 2 protein (ab114913)

Overview

  • Product name
    Recombinant Human Nicotinic Acetylcholine Receptor alpha 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDRLFKHLFRGYNRWARP VPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPAD FGNITSLRVP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      27 to 136

Specifications

Our Abpromise guarantee covers the use of ab114913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACHA2_HUMAN
    • AChR
    • Cholinergic receptor nicotinic alpha 2
    • Chrna2
    • Neuronal acetylcholine receptor protein subunit alpha 2
    • Neuronal acetylcholine receptor subunit alpha-2
    see all
  • Function
    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Involvement in disease
    Defects in CHRNA2 are the cause of nocturnal frontal lobe epilepsy type 4 (ENFL4) [MIM:610353]. ENFL4 is an autosomal dominant epilepsy characterized by nocturnal seizures associated with fear sensation, tongue movements, and nocturnal wandering, closely resembling nightmares and sleep walking.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-2/CHRNA2 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Recombinant Human Nicotinic Acetylcholine Receptor alpha 2 protein images

  • 12.5% SDS-PAGE showing ab114913 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Nicotinic Acetylcholine Receptor alpha 2 protein (ab114913)

ab114913 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up