Recombinant Human Nicotinic Acetylcholine Receptor alpha 4 protein (ab152279)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDE KNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN
    • Amino acids
      29 to 128
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A4 nicotinic receptor
    • Acetylcholine receptor alpha 4 neural
    • Acetylcholine receptor neuronal nicotinic alpha 4 subunit
    • ACH 4
    • ACH4
    • ACHA4_HUMAN
    • AChR
    • Acra 4
    • Acra4
    • Alpha4 nAChR
    • BFNC
    • Cholinergic receptor nicotinic alpha 4
    • Cholinergic receptor nicotinic alpha polypeptide 4
    • CHRNA 4
    • CHRNA4
    • EBN
    • EBN 1
    • EBN1
    • NACHR
    • NACRA 4
    • NACRA4
    • Neuronal acetylcholine receptor subunit alpha-4
    • Neuronal nicotinic acetylcholine receptor alpha 4 subunit
    see all
  • Function
    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Involvement in disease
    Defects in CHRNA4 are the cause of nocturnal frontal lobe epilepsy type 1 (ENFL1) [MIM:600513]; also symbolized ADNFLE. ENFL1 is an autosomal dominant epilepsy characterized by nocturnal seizures with hyperkinetic automatisms and poorly organized stereotyped movements.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-4/CHRNA4 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • ab152279 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up