Recombinant Human Nicotinic Acetylcholine Receptor alpha 5 protein (ab114513)

Overview

  • Product name
    Recombinant Human Nicotinic Acetylcholine Receptor alpha 5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVD EKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      38 to 131

Specifications

Our Abpromise guarantee covers the use of ab114513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetylcholine receptor nicotinic alpha 5 (neuronal)
    • ACHA5_HUMAN
    • AChR
    • Cholinergic receptor neuronal nicotinic alpha polypeptide 5
    • Cholinergic receptor nicotinic alpha 5
    • Cholinergic receptor nicotinic alpha polypeptide 5
    • CHRNA 5
    • CHRNA5
    • LNCR2
    • NACHRA 5
    • NACHRA5
    • Neuronal acetylcholine receptor subunit alpha 5
    • Neuronal acetylcholine receptor subunit alpha-5
    • Neuronal nicotinic acetylcholine receptor alpha 5 subunit
    • Neuronal nicotinic acetylcholine receptor, alpha5 subunit
    • OTTHUMP00000185019
    see all
  • Function
    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • ab114513 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up