Recombinant Human Nicotinic Acetylcholine Receptor alpha 5 protein (ab114513)

Overview

  • Product nameRecombinant Human Nicotinic Acetylcholine Receptor alpha 5 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP30532
    • SpeciesHuman
    • SequenceSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVD EKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
    • Molecular weight36 kDa including tags
    • Amino acids38 to 131

Specifications

Our Abpromise guarantee covers the use of ab114513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetylcholine receptor nicotinic alpha 5 (neuronal)
    • ACHA5_HUMAN
    • AChR
    • Cholinergic receptor neuronal nicotinic alpha polypeptide 5
    • Cholinergic receptor nicotinic alpha 5
    • Cholinergic receptor nicotinic alpha polypeptide 5
    • CHRNA 5
    • CHRNA5
    • LNCR2
    • NACHRA 5
    • NACHRA5
    • Neuronal acetylcholine receptor subunit alpha 5
    • Neuronal acetylcholine receptor subunit alpha-5
    • Neuronal nicotinic acetylcholine receptor alpha 5 subunit
    • Neuronal nicotinic acetylcholine receptor, alpha5 subunit
    • OTTHUMP00000185019
    see all
  • FunctionAfter binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Sequence similaritiesBelongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily.
  • Cellular localizationCell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Recombinant Human Nicotinic Acetylcholine Receptor alpha 5 protein images

  • ab114513 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Nicotinic Acetylcholine Receptor alpha 5 protein (ab114513)

ab114513 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"