Recombinant Human Nicotinic Acetylcholine Receptor alpha 7 protein (ab114193)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTL YYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAE IMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWT RVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDP DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTII CTIGILMSAPNFVEAVSKDFA
    • Molecular weight
      61 kDa including tags
    • Amino acids
      182 to 502
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 7nAChR
    • a7 nicotinic acetylcholine receptor
    • acetylcholine receptor, neuronal nicotinic, alpha-7 subunit
    • ACHA7_HUMAN
    • AChR
    • Acra7
    • alpha 7 neuronal nicotinic acetylcholine receptor
    • alpha-7 nicotinic cholinergic receptor subunit
    • alpha7
    • cholinergic receptor, neuronal nicotinic, alpha polypeptide 7
    • cholinergic receptor, nicotinic, alpha 7
    • cholinergic receptor, nicotinic, alpha 7 (neuronal)
    • cholinergic receptor, nicotinic, alpha polypeptide 7
    • CHRNA7
    • CHRNA7-2
    • NACHRA7
    • neuronal acetylcholine receptor protein, alpha-7 chain
    • Neuronal acetylcholine receptor subunit alpha-7
    see all
  • Function
    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-7/CHRNA7 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • ab114193 on 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Vielen Dank für Ihren Anruf und für Ihr Interesse an unseren Produkten.

Es freut mich Ihnen bestätigen zu können, dass ab114193 höchstwahrscheinlich für Bindungsstudien geeignet ist.

Es liegt in der nat...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up