Recombinant Human Nicotinic Acetylcholine Receptor epsilon protein (ab114817)

Overview

  • Product name
    Recombinant Human Nicotinic Acetylcholine Receptor epsilon protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETL TTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF GVAYDANVLV
    • Molecular weight
      38 kDa including tags
    • Amino acids
      21 to 130

Specifications

Our Abpromise guarantee covers the use of ab114817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetylcholine receptor subunit epsilon
    • ACHE_HUMAN
    • AChR
    • AchR epsilon subunit
    • ACHRE
    • Cholinergic receptor, nicotinic, epsilon polypeptide
    • Chrne
    • CMS1D
    • CMS1E
    • CMS2A
    • FCCMS
    • SCCMS
    see all
  • Function
    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
  • Involvement in disease
    The muscle AChR is the major target antigen in the autoimmune disease myasthenia gravis. Myasthenia gravis is characterized by sporadic muscular fatigability and weakness, occurring chiefly in muscles innervated by cranial nerves, and characteristically improved by cholinesterase-inhibiting drugs.
    Myasthenic syndrome, congenital, 4A, slow-channel
    Myasthenic syndrome, congenital, 4B, fast-channel
    Myasthenic syndrome, congenital, 4C, associated with acetylcholine receptor deficiency
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Epsilon/CHRNE sub-subfamily.
  • Cellular localization
    Cell junction, synapse, postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Recombinant Human Nicotinic Acetylcholine Receptor epsilon protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Nicotinic Acetylcholine Receptor epsilon protein (ab114817)

ab114817 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up