Recombinant Human Nidogen 2 protein (ab153186)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYA DHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
    • Amino acids
      1276 to 1375
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NID 2
    • NID-2
    • Nid2
    • NID2_HUMAN
    • Nidogen-2
    • Nidogen2
    • Osteonidogen
    see all
  • Function
    Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.
  • Tissue specificity
    Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.
  • Sequence similarities
    Contains 5 EGF-like domains.
    Contains 5 LDL-receptor class B repeats.
    Contains 1 NIDO domain.
    Contains 1 nidogen G2 beta-barrel domain.
    Contains 2 thyroglobulin type-1 domains.
  • Post-translational
    modifications
    Highly N- and O-glycosylated.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Images

  • ab153186 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up