Recombinant Human Ninjurin2 protein (ab158999)

Overview

  • Product name
    Recombinant Human Ninjurin2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRL KAVLEQGPSSHYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWR LNQLNNAATILVFFTVVINVFITAFGAHKTGFLAARASRNPL
    • Amino acids
      1 to 142
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Nerve injury induced protein 2
    • Nerve injury-induced protein 2
    • NINJ2
    • NINJ2_HUMAN
    • Ninjurin-2
    see all
  • Function
    Homophilic cell adhesion molecule that promotes axonal growth. May play a role in nerve regeneration and in the formation and function of other tissues.
  • Tissue specificity
    Widely expressed. In adult, higher expression in the bone marrow and peripheral blood lymphocytes, medium in the lung, lymph node, thyroid, uterus, thymus, spleen, prostate and skeletal muscle, lower in the liver, placenta, brain, heart and kidney. In embryo, higher expression in the thymus, heart and liver, lower in the spleen, lung, brain and kidney.
  • Sequence similarities
    Belongs to the ninjurin family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158999 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up