Recombinant Human NIPAL3 protein (ab163519)

Overview

  • Product name
    Recombinant Human NIPAL3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIRLAGSKDPRAY FKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIF IKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMTGENVTRH LVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVALLVLLCHPGW SAVVQS
    • Amino acids
      21 to 226
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9130020G22Rik
    • AI480660
    • DJ462O23.2
    • DKFZp686E22155
    • NIPA like domain containing 3
    • NIPA like protein 3
    • NPAL3
    • OTTHUMP00000003338
    • OTTHUMP00000003341
    • OTTMUSP00000010257
    • RGD1563439
    • RP23-332E2.5
    • RP3-462O23.3
    see all
  • Relevance
    NIPAL3 belongs to the NIPA family.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab163519 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up