Recombinant Human NIPSNAP1 protein (denatured) (ab174557)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAPRLCSISVTARRLLGGPGPRAGDVA SAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFH NVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWR FSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQ PRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGE LYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIP LKISPLQ
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 284
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • NIPSNAP 1
    • Nipsnap homolog 1 (C. elegans)
    • Protein NipSnap homolog 1
  • Relevance
    NIPSNAP is a member of an evolutionarily well conserved gene family and has a strong sequence similarity to the central portion of a protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. Recent studies have indicated that NIPSNAP is involved in the regulation of the Ca2+-selective transient receptor potential vanilloid channel 6 (TRPV6). NIPSNAP1 associates with TRPV6 at the plasma membrane and inhibits TRPV6 currents. Other studies show that NIPSNAP’s expression is reduced in the phenylketonuria (PKU) mouse brain, suggesting that NIPSNAP may play a role in memory.
  • Cellular localization
    Mitochondrial

Images

  • 15% SDS-PAGE analysis of ab174557 (3 µg).

References

ab174557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up