Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVN ELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
    • Amino acids
      81 to 180
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434B0920
    • DKFZp686G0837
    • E3 ubiquitin-protein ligase UHRF2
    • MGC33463
    • Np95 like RING finger protein
    • Np95-like ring finger protein
    • Np95/ICBP90 like RING finger protein
    • Np95/ICBP90-like RING finger protein
    • Nuclear protein 97
    • Nuclear zinc finger protein Np97
    • RING finger protein 107
    • RNF 107
    • RP11-472F14.2
    • Ubiquitin like containing PHD and RING finger domains protein 2
    • Ubiquitin-like PHD and RING finger domain-containing protein 2
    • Ubiquitin-like-containing PHD and RING finger domains protein 2
    • Uhrf2
    • UHRF2_HUMAN
    • URF 2
    see all
  • Function
    E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of PCNP. May participate in methylation-dependent transcriptional regulation. Important for G1/S transition. Overexpression causes G1 phase cell arrest.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 PHD-type zinc finger.
    Contains 2 RING-type zinc fingers.
    Contains 1 ubiquitin-like domain.
    Contains 1 YDG domain.
  • Post-translational
    modifications
    May be autoubiquitinated; which may lead to proteasomal degradation.
    Phosphorylated. Phosphorylation may be mediated by CDK2.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153580 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up