Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDP WGTVVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS
    • Amino acids
      228 to 327
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC57670
    • NIT1
    • NIT1_HUMAN
    • Nitrilase 1
    • Nitrilase homolog 1
    see all
  • Function
    Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2.
  • Tissue specificity
    Detected in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.
    Contains 1 CN hydrolase domain.
  • Cellular localization
    Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • ab159001 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up