Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYG AKYFPEYA EKIPGESTQKLSEVAKECSIYLIGGSIPEEDAGKLYNTCA VFGPDGTLLAKYRKIHLF DIDVPGKITFQESKTLSPGDSFSTFDTPYC RVGLGICYDMRFAELAQIYAQRGCQLLV YPGAFNLTTGPAHWELLQRS RAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVL AKAGTEEAIV YSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP

Specifications

Our Abpromise guarantee covers the use of ab88137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88137 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • CUA002
    • MGC111199
    • NIT 2
    • Nit protein 2
    • NIT2
    • NIT2_HUMAN
    • Nitrilase family member 2
    • Nitrilase homolog 2
    • Omega amidase NIT2
    • Omega-amidase NIT2
    see all
  • FunctionHas a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.
  • Tissue specificityDetected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon.
  • Sequence similaritiesBelongs to the UPF0012 family.
    Contains 1 CN hydrolase domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human NIT2 protein (ab88137)

ab88137 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"